PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009589276.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 254aa    MW: 29914.2 Da    PI: 6.7209
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009589276.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK83.42.2e-26143192352
          RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     + ++l+++++yF+ pi++AAkeL v+lTvLK++CR+++I+RWPhRkiksl
  XP_009589276.1 143 DALELDEIQRYFHVPINKAAKELRVGLTVLKKRCRELNIMRWPHRKIKSL 192
                     6799********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.734126214IPR003035RWP-RK domain
PfamPF020421.2E-23145192IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MDSHVLTLEN QNDQFDWLYS EHPPPPFGTW QHQDSRILSN GGLFNFEYFD PFQFPSDIQN  60
NHLPTFFDLK EFEEICQDLG TLDVKLPPFQ EEIPLNMTFT PLEECQNYVT STMISSGERE  120
IINGTNKELI MKRNNNGRHK KSDALELDEI QRYFHVPINK AAKELRVGLT VLKKRCRELN  180
IMRWPHRKIK SLQTLIDSVK EMGLTSEVEM LEEHQRMLEK VPEMALTERT KKLRQTCFKA  240
NYKKRRAAMA AFSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009589276.10.0PREDICTED: protein RKD4
TrEMBLM1BL911e-116M1BL91_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000476811e-116(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA121431922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53040.15e-41RWP-RK domain-containing protein